DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox6

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_031755685.1 Gene:sox6 / 100144640 XenbaseID:XB-GENE-483934 Length:804 Species:Xenopus tropicalis


Alignment Length:229 Identity:66/229 - (28%)
Similarity:101/229 - (44%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SLAAMGGSPN---GPA---GQGVNGSSGMGHH---MSSHMTPHHMHQAVSAQQTLSPNSSIGS-- 101
            ||:...|.|:   ||:   ...:|..:..|..   |.:......|.:.:..:|.|:|:|..|.  
 Frog   443 SLSNKSGIPSPIRGPSLDILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQLLTPHSIDGKLP 507

  Fly   102 -------------------AGSLGSQS---------SLGSNGSGLNSSSGHQSAGMHSLATSPGQ 138
                               .|.:..:|         :||...:|..:..|....|:..|......
 Frog   508 INNMGLNNCRSDKMLLDAVTGKICIRSAHTERTHFENLGPQLTGKPNEDGKLGPGVIDLTRPEDV 572

  Fly   139 EG---------------------HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKL 182
            ||                     ||||||||||||::.:||:|.:..|.||||.|||.||:.||.
 Frog   573 EGGATVVEARVYRDTRGRSSSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKA 637

  Fly   183 LAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            ::..||:|:.:|..||..:|::::|:|||:||.|
 Frog   638 MSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 37/70 (53%)
sox6XP_031755685.1 SOX-TCF_HMG-box 596..667 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.