DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox14

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001093703.1 Gene:sox14 / 100101715 XenbaseID:XB-GENE-485370 Length:239 Species:Xenopus tropicalis


Alignment Length:256 Identity:110/256 - (42%)
Similarity:133/256 - (51%) Gaps:65/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            ||||||||||||||.|||::|::||||||||||||||||||||:|:||||:|||||||||.||||
 Frog     7 HIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKE 71

  Fly   206 HPDYKYRPRRKPKN------------------PLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGY 252
            ||||||||||||||                  ||    :.||.|.|   ....|||...|.|   
 Frog    72 HPDYKYRPRRKPKNLLKKDRYVFPLPYLGDHDPL----KTGLSMSA---TDSLLGASEKARA--- 126

  Fly   253 NPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTS 317
                .|||..||...||...       |....:.|:.:.....||:.             ||..|
 Frog   127 ----FLPPTSAPYSLLDPSQ-------FSSTTIQKMTEMPHTLAAST-------------LPYAS 167

  Fly   318 LSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSALRRPV 378
            ...:.:|.:.|:|.||.: .|:      :||.      ::||.:.|........|.|:.||
 Frog   168 TLGYQNGAFGGLSCPSQH-THT------HPSP------TNPGYVVPCNCSAWSASNLQPPV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
sox14NP_001093703.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)
SOXp 77..>95 CDD:372055 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4123
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.