Sequence 1: | NP_001261830.1 | Gene: | D / 39570 | FlyBaseID: | FBgn0000411 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093691.1 | Gene: | sox10 / 100101700 | XenbaseID: | XB-GENE-480304 | Length: | 436 | Species: | Xenopus tropicalis |
Alignment Length: | 323 | Identity: | 100/323 - (30%) |
---|---|---|---|
Similarity: | 133/323 - (41%) | Gaps: | 111/323 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
Fly 206 HPDYKYRPRR----KP----------------------KN---------PL-------TAGPQGG 228
Fly 229 ---------LQMQAGGM-----GQQKLGAG--PGAGAGG------------------YNPFHQLP 259
Fly 260 PYFAPSHHLDQGYPVPYFGGF--------------DPLALSKLH-QSQAAAAAAVNNQGQQQGQA 309
Fly 310 PP---QLPPTSLS-SFYSGIYSGISAP----------SLYAAHSANAAGLYPSSSTSSPGSSP 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
D | NP_001261830.1 | SOX-TCF_HMG-box | 141..212 | CDD:238684 | 43/70 (61%) |
sox10 | NP_001093691.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..55 | ||
Sox_N | 12..79 | CDD:372113 | |||
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P56693 | 48..88 | ||||
SOX-TCF_HMG-box | 89..159 | CDD:238684 | 42/69 (61%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..183 | 16/37 (43%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 195..257 | 12/61 (20%) | |||
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P56693 | 209..295 | 20/91 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 322..346 | 3/23 (13%) | |||
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P56693 | 327..436 | 21/79 (27%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 413..436 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |