DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox10

DIOPT Version :10

Sequence 1:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001093691.1 Gene:sox10 / 100101700 XenbaseID:XB-GENE-480304 Length:436 Species:Xenopus tropicalis


Alignment Length:323 Identity:100/323 - (30%)
Similarity:133/323 - (41%) Gaps:111/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||::..||::|...|.:||:|:||.||..|:||.|::|||||:||:|||..|.|:
 Frog    89 HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNENDKRPFIEEAERLRMQHKKD 153

  Fly   206 HPDYKYRPRR----KP----------------------KN---------PL-------TAGPQGG 228
            ||||||:|||    ||                      ||         |:       :||...|
 Frog   154 HPDYKYQPRRRKNGKPNPGEGDGSSEAEGGAASIQAHYKNSHLDHRHGSPMSDGNSEHSAGQSHG 218

  Fly   229 ---------LQMQAGGM-----GQQKLGAG--PGAGAGG------------------YNPFHQLP 259
                     .::|||..     |.:.||.|  |....|.                  .|.|.|  
 Frog   219 PPTPPTTPKTELQAGKSDGKRDGSRSLGEGGKPHIDFGNVDIGEISHDVMANMETFDVNEFDQ-- 281

  Fly   260 PYFAPSHHLDQGYPVPYFGGF--------------DPLALSKLH-QSQAAAAAAVNNQGQQQGQA 309
             |..|:.|  .|:| .:.||:              ...||:|.| |:.:.|.....:........
 Frog   282 -YLPPNGH--AGHP-SHIGGYTSSYGLSGALAAGPSAWALAKQHPQTDSKAQVKTESSSTSHYTE 342

  Fly   310 PP---QLPPTSLS-SFYSGIYSGISAP----------SLYAAHSANAAGLYPSSSTSSPGSSP 358
            .|   ||..|||. ..|...:..||.|          |.|.:||:.|:.||.:.|...|...|
 Frog   343 QPSTSQLTYTSLGLPHYGSAFPSISRPQFDYADHQPSSSYYSHSSQASSLYSAFSYMGPPQRP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 49/103 (48%)
sox10NP_001093691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Sox_N 12..79 CDD:463586
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P56693 48..88
HMG-box_SoxE 89..163 CDD:438840 45/73 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..183 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..257 12/61 (20%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P56693 209..295 20/91 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..346 3/23 (13%)
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P56693 327..436 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.