DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox17b.2

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001090837.1 Gene:sox17b.2 / 100038235 XenbaseID:XB-GENE-495335 Length:351 Species:Xenopus tropicalis


Alignment Length:293 Identity:86/293 - (29%)
Similarity:129/293 - (44%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ATSPGQ-EGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAK 196
            |.|.|: |..|:|||||||||::.:|:::|:.||.:||:|:||.||..||.|..:.||||:.||:
 Frog    26 ANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVKEAE 90

  Fly   197 RLRALHMKEHPDYKYRPRRK-----------PKNPLTAGPQ---------GGLQMQAGGMGQQKL 241
            |||..|::::||||||||||           |...: .|||         ...:||..|...|:.
 Frog    91 RLRVQHIQDYPDYKYRPRRKKQVKREEEGFLPSADI-PGPQVMGCNAMVGQNYKMQYSGQNSQQS 154

  Fly   242 GAGPGAGAGGYNPF------HQLPPYF------------------APSHHLDQGYPVPYFGGFDP 282
            ...|......:||.      :.:|.|:                  |.|::.:..| :||......
 Frog   155 QITPAGYFEDHNPVGFYYRGYNVPKYYMSQNSSGYCSPPTQGEYQALSYNFNSSY-IPYQQNASA 218

  Fly   283 LALSKLHQSQAAAAAAVNNQGQQQG----QAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAA 343
            .|:.|    |.|....:..:..:.|    |..||:            |:|    .:|....|...
 Frog   219 PAMGK----QMAVKENIIQESPEHGIMGCQVSPQM------------YNG----QMYVPECAKTH 263

  Fly   344 GLYPSSSTSSPGSSPGTIT----PNGMDGSMDS 372
            .:..:...||...|...:|    |:..||.::|
 Frog   264 PVAQTEQHSSLHQSQQMVTQNYLPSQQDGHLES 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
sox17b.2NP_001090837.1 SOX-TCF_HMG-box 35..106 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.