DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox21

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002939326.1 Gene:sox21 / 100038091 XenbaseID:XB-GENE-486445 Length:271 Species:Xenopus tropicalis


Alignment Length:264 Identity:111/264 - (42%)
Similarity:139/264 - (52%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKE 205
            |:||||||||||||.|||::|::||||||||||||||||||||.|:||||||||||||||:||||
 Frog     7 HVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTEAEKRPFIDEAKRLRAMHMKE 71

  Fly   206 HPDYKYRPRRKPKNPLT------------AGPQGGLQMQ----AGGM------GQQKLGAGPGAG 248
            |||||||||||||..|.            .|...||::.    ||.:      ..:|..|...|.
 Frog    72 HPDYKYRPRRKPKTLLKKDKFAFPMPYGFTGDHDGLKVAGLHGAGALTDSLLSNPEKAAAAAAAA 136

  Fly   249 AGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFD-PLALSKLHQSQAAAAAAVNNQGQQQGQAPPQ 312
            |...        :|.||............||.: |.:|..|....|...::.::           
 Frog   137 AARV--------FFPPSAAAAAAAAAAAAGGANHPYSLFDLSSKMAEITSSSSS----------- 182

  Fly   313 LPPTSLSSF---YSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSAL 374
            ||.||...:   ..|.:.|::|    ||.:|.|||...:.|..||| :||.:.|....|.....|
 Frog   183 LPYTSSIGYPQASGGAFPGVAA----AAAAAAAAGGGHTHSHPSPG-NPGYMIPCNCTGWPSPGL 242

  Fly   375 RRPV 378
            :.|:
 Frog   243 QPPL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/70 (87%)
sox21XP_002939326.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)
SOXp 77..>95 CDD:372055 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4123
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.