DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX13

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_005677.2 Gene:SOX13 / 9580 HGNCID:11192 Length:622 Species:Homo sapiens


Alignment Length:364 Identity:106/364 - (29%)
Similarity:154/364 - (42%) Gaps:73/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSLAHPLQTHLGSGGGTHHLGQ--LAAAVHQQQQQQ-----QQSDQGLGHSHHLHGQQLSLN--- 68
            |.:.|.|.| |.....|.|..|  :||.:.::||||     ||.:|.......|..||..:|   
Human   153 LVMIHQLST-LRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQ 216

  Fly    69 ---HQHHHPH-QSPQHQQQHQHHPCSSNSSNGSPNGSTGLGLHPHSALHLAHHHSQLHQ------ 123
               .|.:.|: ..|.....||..|.       :|:....|.:.|.....:.:....||.      
Human   217 QQIQQVNMPYVMIPAFPPSHQPLPV-------TPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVV 274

  Fly   124 --------HHPAGQQQQHSQP------------PVSSSSTSHHSQSQALSHQTHSNGSSQLGGGS 168
                    |||.   |:.|||            |.:|||.|....|......:|...:..|....
Human   275 KRPGAMATHHPL---QEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSP 336

  Fly   169 AS-GAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNS-QASPISNLHQNMGSLMNSGSS----- 226
            .| ..|.:..|.|       .:.::..|....|.|..: ..||.:...:::.||.:|.:.     
Human   337 PSLPLGFLGEGDA-------VTKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLED 394

  Fly   227 -----ASDVFFSLMIQNT---TKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLG 283
                 ..:...|..:..:   .:.:|..||||||||||||::.:||||.|..|.||||.|||.||
Human   395 GCVHPLEEAMLSCDMDGSRHFPESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILG 459

  Fly   284 AEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRK 322
            :.||.:|.:||:|:.:|..||...|::::|||||:||.|
Human   460 SRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 41/70 (59%)
SOX13NP_005677.2 SOX-TCF_HMG-box 423..494 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.