DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX7

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_113627.1 Gene:SOX7 / 83595 HGNCID:18196 Length:388 Species:Homo sapiens


Alignment Length:327 Identity:85/327 - (25%)
Similarity:121/327 - (37%) Gaps:160/327 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMH 308
            :|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.||..:|||::|||:|||..|
Human    41 SESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQH 105

  Fly   309 MKEHPDYKYRPRRKPKALRR--------------------------------------------- 328
            |:::|:||||||||.:|.|.                                             
Human   106 MQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALGEKEDRGEYSPGTA 170

  Fly   329 ------------------------DGYPYPMPYP------------------------------- 338
                                    |.|||.:|.|                               
Human   171 LPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRRIP 235

  Fly   339 ------------------SVPVEALRAGITPG---------------YFAPGPTAAAYH-----L 365
                              |.|:.:|..|.:||               |::|    |.||     |
Human   236 HLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSP----ATYHPLHSNL 296

  Fly   366 GSHLGQTSTP----------TTTQATLSGQMDKFALERSSYLS------NSSQASAYSAYLDPSV 414
            .:||||.|.|          ..:|..|.|.||:  .|...||:      :::.|.|.|.::..|.
Human   297 QAHLGQLSPPPEHPGFDALDQLSQVELLGDMDR--NEFDQYLNTPGHPDSATGAMALSGHVPVSQ 359

  Fly   415 LT 416
            :|
Human   360 VT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 39/70 (56%)
SOX7NP_113627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..46 1/4 (25%)
SOX-TCF_HMG-box 44..115 CDD:238684 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..197 1/56 (2%)
Sox_C_TAD 198..386 CDD:288887 35/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.