Sequence 1: | NP_001261829.1 | Gene: | Sox21b / 39569 | FlyBaseID: | FBgn0042630 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113627.1 | Gene: | SOX7 / 83595 | HGNCID: | 18196 | Length: | 388 | Species: | Homo sapiens |
Alignment Length: | 327 | Identity: | 85/327 - (25%) |
---|---|---|---|
Similarity: | 121/327 - (37%) | Gaps: | 160/327 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 NEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMH 308
Fly 309 MKEHPDYKYRPRRKPKALRR--------------------------------------------- 328
Fly 329 ------------------------DGYPYPMPYP------------------------------- 338
Fly 339 ------------------SVPVEALRAGITPG---------------YFAPGPTAAAYH-----L 365
Fly 366 GSHLGQTSTP----------TTTQATLSGQMDKFALERSSYLS------NSSQASAYSAYLDPSV 414
Fly 415 LT 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21b | NP_001261829.1 | SOX-TCF_HMG-box | 247..318 | CDD:238684 | 39/70 (56%) |
SOX7 | NP_113627.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..46 | 1/4 (25%) | |
SOX-TCF_HMG-box | 44..115 | CDD:238684 | 39/70 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 140..197 | 1/56 (2%) | |||
Sox_C_TAD | 198..386 | CDD:288887 | 35/170 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.940 |