DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:120 Identity:27/120 - (22%)
Similarity:61/120 - (50%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHI-----KRPMNAFMVWSR 260
            |....:...:..||:.....|......:|..  :..:..||::..|::     |:|.:::.::|:
plant   329 LSQKKEEEELLKLHKQEALQMLKKKEKTDNL--IKKEKATKKKKNENVDPNKPKKPASSYFLFSK 391

  Fly   261 LQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDY 315
            .:|:|:.::.|..:|:.::..:..:||.|:||||:.:..:|.:|...:.||...|
plant   392 DERKKLTEERPGTNNATVTALISLKWKELSEEEKQVYNGKAAKLMEAYKKEVEAY 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 20/75 (27%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 27/120 (23%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.