DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox18

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017209261.1 Gene:sox18 / 797246 ZFINID:ZDB-GENE-080725-1 Length:431 Species:Danio rerio


Alignment Length:436 Identity:117/436 - (26%)
Similarity:160/436 - (36%) Gaps:127/436 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSH--------HSAPASSS--- 191
            :|.||....:.||          .||:......||.|...|....|        ..||...|   
Zfish     3 ISESSCCQEASSQ----------PSQVAERGTWGASSSTPGPERGHGFDRSRTTELAPVPGSGTR 57

  Fly   192 -VMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAF 255
             |...||.|.........|        |:| ..|||..            |...|..|:||||||
Zfish    58 TVSRTAAEARTGSPDSTRP--------GAL-TLGSSEG------------KSGGESRIRRPMNAF 101

  Fly   256 MVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPR 320
            |||::.:|:::|..||.:||:.:||.||..||.|:..:||||::||:|||..|:::||:||||||
Zfish   102 MVWAKDERKRLAIQNPDLHNAVLSKMLGQSWKALSTLDKRPFVEEAERLRLQHLQDHPNYKYRPR 166

  Fly   321 RK--PKALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAYHLGSHLGQ------TSTPTT 377
            ||  ||.::|       ..|.:.::.|..| .|| .|..|...|:||...||.      :..|  
Zfish   167 RKKQPKKMKR-------VEPGLLLQGLAHG-GPG-DAYSPHRHAHHLLPPLGHFRDLHPSGAP-- 220

  Fly   378 TQATLSGQMDKFAL--ERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKIY 440
                   :::.|.|  ...|.|....:....|.:..|.:.......|.:      ||       :
Zfish   221 -------ELESFGLPTPEMSPLDVLEEGGGDSVFFPPHMQEDVGLSSWI------NY-------H 265

  Fly   441 GAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNN-NSSSGLDDRDATPQLEAV 504
            ....|...||........|.                      ||.: |..|.|.......:...|
Zfish   266 QHPNHQPGHHPHHNSHNLQH----------------------SHPHLNQKSPLACLPLQEKCLVV 308

  Fly   505 ESK------PHLHSPSDVGLDYAQYAQQYG------------GQLA 532
            ||.      |::..|......|  |.|.||            |||:
Zfish   309 ESPNPGGLYPNMTLPESSKAGY--YGQIYGSSQPQPAFTSHLGQLS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 37/70 (53%)
sox18XP_017209261.1 SOX-TCF_HMG-box 93..164 CDD:238684 37/70 (53%)
Sox_C_TAD 207..429 CDD:288887 34/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.