DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox12

DIOPT Version :10

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:105 Identity:57/105 - (54%)
Similarity:68/105 - (64%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKE 311
            |||||||||||||:.:||||....|.|||:|||||||..|:||.:.||.||:.||:|||..||.:
  Rat    39 HIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMAD 103

  Fly   312 HPDYKYRPRRKPKALRRDGYPYP----------MPYPSVP 341
            :||||||||:|.|.......|.|          .|.|.:|
  Rat   104 YPDYKYRPRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 51/77 (66%)
Sox12NP_001162121.1 HMG-box_SF 29..116 CDD:469606 51/76 (67%)

Return to query results.
Submit another query.