DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SRY

DIOPT Version :10

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_003131.1 Gene:SRY / 6736 HGNCID:11311 Length:204 Species:Homo sapiens


Alignment Length:139 Identity:62/139 - (44%)
Similarity:93/139 - (66%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 AAAAAHLHHNSQASPISNLHQNMGSLMNSGS----SASDVFFSLMIQNTTKRQNEEHIKRPMNAF 255
            |:|...:.::...||.  :.:|:.:|..|.|    .:.:..:.......:|...::.:|||||||
Human     5 ASAMLSVFNSDDYSPA--VQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAF 67

  Fly   256 MVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPR 320
            :||||.||||:|.:||:|.||||||:||.:||:|||.||.||..||::|:|||.:::|:||||||
Human    68 IVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPR 132

  Fly   321 RKPKALRRD 329
            ||.|.|.::
Human   133 RKAKMLPKN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 51/78 (65%)
SRYNP_003131.1 HMG-box_SoxA_SRY 56..140 CDD:438843 53/83 (64%)
Sufficient for interaction with KPNB1. /evidence=ECO:0000269|PubMed:15297880 59..136 51/76 (67%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:12764225, ECO:0000269|PubMed:15746192 61..77 13/15 (87%)
Sufficient for interaction with EP300. /evidence=ECO:0000269|PubMed:15297880 107..139 18/31 (58%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:15297880 130..136 5/5 (100%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 138..155 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..204
Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269|PubMed:9054412 198..204
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.