DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX11

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens


Alignment Length:413 Identity:113/413 - (27%)
Similarity:147/413 - (35%) Gaps:139/413 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKE 311
            |||||||||||||:::||||.:.:|.|||:|||||||..||:|.:.||.|||.||:|||..||.:
Human    48 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMAD 112

  Fly   312 HPDYKYRPRRKPKALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAYHLGS--HLGQTST 374
            :||||||||:|||.     .|...|..|...|...||...|....|...|....||  ..|:...
Human   113 YPDYKYRPRKKPKM-----DPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKA 172

  Fly   375 PTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKI 439
            |....|....             ..::|:..|....|..||                        
Human   173 PAAAGAKAGA-------------GKAAQSGDYGGAGDDYVL------------------------ 200

  Fly   440 YGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDRDATPQL--- 501
                                     ..|.:||.||.|.|.:......:.....||.|...||   
Human   201 -------------------------GSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIK 240

  Fly   502 ----EAVESKPHLHSPSDVGLDYAQYAQQY-------GGQLAAAAGGAVG---------GGAAGA 546
                |..|..||.......|...:|..::|       ...|:::|....|         |..:||
Human   241 QEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGA 305

  Fly   547 AGGS---------------------------------------AGGGSGGATAADFRRPLTVIFX 572
            .|||                                       :..||.|..|.|....|::.|.
Human   306 GGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFS 370

  Fly   573 PPSSNGSEEL--------NLSMT 587
            ..:.:.||:.        |||::
Human   371 QSAHSASEQQLGGGAAAGNLSLS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 47/70 (67%)
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SOX-TCF_HMG-box 48..119 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 35/166 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 3/39 (8%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.