DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX10

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_008872.1 Gene:SOX10 / 6663 HGNCID:11190 Length:466 Species:Homo sapiens


Alignment Length:521 Identity:129/521 - (24%)
Similarity:194/521 - (37%) Gaps:161/521 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SQSQALSHQTHSNGSSQ----LGGGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQA 207
            ::.|.||....|...|:    |..|||...|...||..:...::|....:   ........:.:|
Human     2 AEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGEL---GKVKKEQQDGEA 63

  Fly   208 S----PISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQ 268
            .    |:. :.:.:..:: ||...:.|...:.:...:|  ::.|:||||||||||::..|||:|.
Human    64 DDDKFPVC-IREAVSQVL-SGYDWTLVPMPVRVNGASK--SKPHVKRPMNAFMVWAQAARRKLAD 124

  Fly   269 DNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPY 333
            ..|.:||:|:||.||..|:||.|.:|||||:||:|||..|.|:||||||:|||:.......|   
Human   125 QYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQG--- 186

  Fly   334 PMPYPSVPVEALRAGITPGYFAPGPTAA--AYHLGSHL------------------------GQT 372
                     ||...|   |....|.|||  |::..:||                        |..
Human   187 ---------EAECPG---GEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPP 239

  Fly   373 STPTTTQATL-SGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDI 436
            :.|||.:..| ||:.|.   :|    ...|.......::|        |.:           .||
Human   240 TPPTTPKTELQSGKADP---KR----DGRSMGEGGKPHID--------FGN-----------VDI 278

  Fly   437 SKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSG---------GGGSGGGGS---ASSHN---- 485
            .:|        :|......:.....:..|.|..:|         ..|.|.|.:   ||.|:    
Human   279 GEI--------SHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWIS 335

  Fly   486 --------NNSSSGLD-------------------DRDATPQLEAVE-SKPHLHSP----SDVGL 518
                    ..|..|:|                   |:.:|.|:.... |.||..|.    |....
Human   336 KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQF 400

  Fly   519 DYAQYAQQYGGQLAAAAGGAVGGGAAGAAGGSAGGGSGGATAADF----RRPLTVIFXPPSSNGS 579
            ||:.:.                  .:|...|.:|..||..:|..:    :|||.... .||.:|.
Human   401 DYSDHQ------------------PSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGP 447

  Fly   580 E 580
            :
Human   448 Q 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 44/70 (63%)
SOX10NP_008872.1 Sox_N 12..93 CDD:315171 15/85 (18%)
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 62..102 6/43 (14%)
SOX-TCF_HMG-box 103..173 CDD:238684 43/69 (62%)
Nuclear export signal 134..145 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..199 18/53 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..274 12/76 (16%)
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 228..310 19/115 (17%)
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 353..466 22/114 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..375 1/20 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..466 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.