DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX4

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens


Alignment Length:419 Identity:117/419 - (27%)
Similarity:148/419 - (35%) Gaps:195/419 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QTHS--NGSSQLGGGSA-SGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQN 216
            ||::  |..:.|.|.|: ||||...|.|                         |..:|       
Human     4 QTNNAENTEALLAGESSDSGAGLELGIA-------------------------SSPTP------- 36

  Fly   217 MGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKR 281
             ||..::|..|.|..:.        :....|||||||||||||:::||||.:.:|.|||:|||||
Human    37 -GSTASTGGKADDPSWC--------KTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKR 92

  Fly   282 LGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYPMPYPSVPVEALR 346
            ||..||||.:.:|.|||.||:|||..||.::||||||||:|.|                      
Human    93 LGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVK---------------------- 135

  Fly   347 AGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLD 411
                                                ||.            :|||.::|.|    
Human   136 ------------------------------------SGN------------ANSSSSAAAS---- 148

  Fly   412 PSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSG 476
                      ||..:..        .|:.|                            |||||.|
Human   149 ----------SKPGEKG--------DKVGG----------------------------SGGGGHG 167

  Fly   477 GGGSASSHN-----NNSSSGLDDRDATPQLEAVESKPHLHSPSDVGLDYAQYAQQYGGQLAAAAG 536
            |||...|.|     ..:|.|           ...|||            || .:..|.::|..||
Human   168 GGGGGGSSNAGGGGGGASGG-----------GANSKP------------AQ-KKSCGSKVAGGAG 208

  Fly   537 GAVGGGAAG--AAGGSAGGGSGGATAADF 563
            |.|....|.  .|||..||.:..|.||.|
Human   209 GGVSKPHAKLILAGGGGGGKAAAAAAASF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 47/70 (67%)
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 19/94 (20%)
SOX-TCF_HMG-box 58..129 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 46/243 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.