DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX2

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_003097.1 Gene:SOX2 / 6657 HGNCID:11195 Length:317 Species:Homo sapiens


Alignment Length:286 Identity:109/286 - (38%)
Similarity:137/286 - (47%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLR 305
            ::.:.:.:||||||||||||.||||:||:||||||||||||||||||||:|.|||||||||||||
Human    34 QKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLR 98

  Fly   306 AMHMKEHPDYKYRPRRKPKAL-RRDGYPYPMPYPSVPVEALRAGITPGYFAPG--PTAAAYHLGS 367
            |:|||||||||||||||.|.| ::|.|..|                .|..|||  ..|:...:|:
Human    99 ALHMKEHPDYKYRPRRKTKTLMKKDKYTLP----------------GGLLAPGGNSMASGVGVGA 147

  Fly   368 HLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANY 432
            .||         |.::.:||.:|     :::..|..| ||                |.||:....
Human   148 GLG---------AGVNQRMDSYA-----HMNGWSNGS-YS----------------MMQDQLGYP 181

  Fly   433 AFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDRDA 497
            .......:||.|....|.......|.......|..:    .||.....:.|........|....:
Human   182 QHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYM----NGSPTYSMSYSQQGTPGMALGSMGS 242

  Fly   498 TPQLEAVESKP------HLHSPSDVG 517
            ..:.||..|.|      |..:|...|
Human   243 VVKSEASSSPPVVTSSSHSRAPCQAG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 62/70 (89%)
SOX2NP_003097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 0/8 (0%)
SOX-TCF_HMG-box 40..111 CDD:238684 62/70 (89%)
SOXp 110..200 CDD:315092 34/136 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..266 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4785
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm41974
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.