DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX1

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_005977.2 Gene:SOX1 / 6656 HGNCID:11189 Length:391 Species:Homo sapiens


Alignment Length:440 Identity:142/440 - (32%)
Similarity:175/440 - (39%) Gaps:156/440 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQA 207
            |..||...|.: .|:.:|.:..|||...|.|...||.|                           
Human     8 TDLHSPGGAQA-PTNLSGPAGAGGGGGGGGGGGGGGGA--------------------------- 44

  Fly   208 SPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPK 272
                                              :.|::.:||||||||||||.||||:||:|||
Human    45 ----------------------------------KANQDRVKRPMNAFMVWSRGQRRKMAQENPK 75

  Fly   273 MHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKA-LRRDGYPYPMP 336
            |||||||||||||||:::|.||||||||||||||:|||||||||||||||.|. |::|.|     
Human    76 MHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKY----- 135

  Fly   337 YPSVPVEALRAGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSS 401
                   :|..|:.......|..|.|..:|..:|         |...||    .||       |.
Human   136 -------SLAGGLLAAGAGGGGAAVAMGVGVGVG---------AAAVGQ----RLE-------SP 173

  Fly   402 QASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQ 466
            ..:|...|              .:.:..||.|:.     |:...|||.....|:.|         
Human   174 GGAAGGGY--------------AHVNGWANGAYP-----GSVAAAAAAAAMMQEAQ--------- 210

  Fly   467 LLLSGGGGSGGGGSASSHNNNSSSGLDDRDATPQLEAVESKPHLHSPS---DVG-LDYAQYAQQ- 526
              |:.|...|.|| |..|.:         .|.|......:.||...|.   |:| |.|:..:.. 
Human   211 --LAYGQHPGAGG-AHPHAH---------PAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQ 263

  Fly   527 ---------YGG-------QLAAAAGGAVGGGAAGAAGGSAGGGSGGATA 560
                     |||       ..|||||||....|..||..:|...||...|
Human   264 GYMSASPSGYGGLPYGAAAAAAAAAGGAHQNSAVAAAAAAAAASSGALGA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 60/70 (86%)
SOX1NP_005977.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 15/105 (14%)
SOX-TCF_HMG-box 50..121 CDD:238684 60/70 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4785
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.