DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX17

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_071899.1 Gene:SOX17 / 64321 HGNCID:18122 Length:414 Species:Homo sapiens


Alignment Length:433 Identity:112/433 - (25%)
Similarity:163/433 - (37%) Gaps:135/433 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFF 232
            |:..||..:...:.:..:.||   |||.........:  .|||.::.....:..|||:.|.    
Human     2 SSPDAGYASDDQSQTQSALPA---VMAGLGPCPWAES--LSPIGDMKVKGEAPANSGAPAG---- 57

  Fly   233 SLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPF 297
                 ...:.:.|..|:|||||||||::.:|:::||.||.:||:|:||.||..||.||..|||||
Human    58 -----AAGRAKGESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPF 117

  Fly   298 IDEAKRLRAMHMKEHPDYKYRPRRKP--KALRR--DGYPYPMPYPS----------VPVEALRAG 348
            ::||:|||..||::||:|||||||:.  |.|:|  .|:.:.:..|.          |.::.|...
Human   118 VEEAERLRVQHMQDHPNYKYRPRRRKQVKRLKRVEGGFLHGLAEPQAAALGPEGGRVAMDGLGLQ 182

  Fly   349 ITPGYFAPGPTAAAYHLGSH-----------LGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQ 402
            .....|..||.....|:|.|           |.....||...:.|.|                  
Human   183 FPEQGFPAGPPLLPPHMGGHYRDCQSLGAPPLDGYPLPTPDTSPLDG------------------ 229

  Fly   403 ASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKI---------------------------- 439
                   :||.   .|:|.:.|..|..|...:..:::                            
Human   230 -------VDPD---PAFFAAPMPGDCPAAGTYSYAQVSDYAGPPEPPAGPMHPRLGPEPAGPSIP 284

  Fly   440 ------------YGAQQHAAA----HHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNS 488
                        |||.....|    ..|.|.|.|.|.|.|..         ..|.|..|.    .
Human   285 GLLAPPSALHVYYGAMGSPGAGGGRGFQMQPQHQHQHQHQHH---------PPGPGQPSP----P 336

  Fly   489 SSGLDDRDATP---------QLEAVESKPHLH--SPSDVGLDY 520
            ...|..||.|.         :::..|.:.:||  ...::||.|
Human   337 PEALPCRDGTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 42/70 (60%)
SOX17NP_071899.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..66 7/38 (18%)
SOX-TCF_HMG-box 67..138 CDD:238684 42/70 (60%)
Sox_C_TAD 201..412 CDD:288887 37/220 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..286 0/29 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..352 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.