DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox5

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_021330769.1 Gene:sox5 / 567413 ZFINID:ZDB-GENE-000607-13 Length:763 Species:Danio rerio


Alignment Length:520 Identity:130/520 - (25%)
Similarity:192/520 - (36%) Gaps:165/520 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLSLAHPLQ----THLGSGGGTHHLGQLAAAVHQQQQQQQQSDQGLGHSHHLHGQQLSLNHQHHH 73
            |.|..:|||    |...:...|..||.|         |.||          |:..||:       
Zfish   305 GCSEPYPLQLIPTTMAAAAAATPGLGPL---------QLQQ----------LYAAQLA------- 343

  Fly    74 PHQSPQHQQQHQHHPCSSNSSNGSPNGSTGLGLHPHSALHLAHHHSQLHQHHPAGQQQQHSQPPV 138
                     ..|..|.:.:|:....|.:||. |.|.|.      .|:.::..|..:.:.....|:
Zfish   344 ---------AMQVSPGAKHSTVPQANLATGT-LSPTSG------QSEKNRSTPPPKPKDEGAQPL 392

  Fly   139 SSSSTSHHSQSQALSHQTHSNGSSQ-----LGGGSAS-GAGSVAGGAANSHHSAPASSSVMAA-- 195
            :.||....|:|::.:    |..|.|     ||.||.. .|.|..||..:...|....||:.:|  
Zfish   393 NLSSKPKASESKSPT----SPASPQVPALKLGPGSLKHSAPSSIGGPPSRLSSIDLLSSITSAGY 453

  Fly   196 --------------------------------AAAAHLHHNS---------QASPISNLHQNM-- 217
                                            ||...|..|:         :.:.:.:|.|.:  
Zfish   454 LNDHEAVTKAFQEARKMKEQLKREEQVLDAKVAAVNSLSLNNGRSEKVRFMEKAALESLSQQLKQ 518

  Fly   218 -------GSLMNSG-SSASD----VFFSLMIQNTTKR-QNEEHIKRPMNAFMVWSRLQRRKIAQD 269
                   .::|:.| |..||    |..|.:.:....| .:|.||||||||||||::.:||||.|.
Zfish   519 SEESKFTHAMMDFGISGDSDGSPSVSDSRIFREARGRGSSEPHIKRPMNAFMVWAKDERRKILQA 583

  Fly   270 NPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKP----------- 323
            .|.||||.|||.||:.||.:|..||:|:.:|..||...|::::|||||:||.|.           
Zfish   584 FPDMHNSNISKILGSRWKSMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRI 648

  Fly   324 ---KALRRD-----------GYPYPMPYPSVPVEALRAGITPGYFA----PGPTAAAYHLGSHLG 370
               ||:.|:           |....:|..|..|      :.||..:    |.|...:.|......
Zfish   649 GEYKAIMRNRRQEMRQYFTVGQQAQLPLSSAGV------VYPGALSMAGMPSPQMPSEHSSMSSS 707

  Fly   371 QTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFD 435
            ....|.|:||:...:::....|.......:..|                :|...|:|...:|..|
Zfish   708 PEPVPPTSQASYFKEVEPRVKEELRMDDGNGDA----------------YDDFDYEDDDGDYGSD 756

  Fly   436  435
            Zfish   757  756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 41/70 (59%)
sox5XP_021330769.1 SSL_OB 332..>415 CDD:332684 26/128 (20%)
SOX-TCF_HMG-box 561..632 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.