DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox1b

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001032751.1 Gene:sox1b / 562710 ZFINID:ZDB-GENE-060322-5 Length:340 Species:Danio rerio


Alignment Length:327 Identity:121/327 - (37%)
Similarity:155/327 - (47%) Gaps:77/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SPISNLHQNMGSL-MNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNP 271
            ||.:..:.|.|.. .||||                :.|::.:||||||||||||.||||:||:||
Zfish    12 SPGAQTNTNTGHTGPNSGS----------------KVNQDRVKRPMNAFMVWSRGQRRKMAQENP 60

  Fly   272 KMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKA-LRRDGYPYPM 335
            |||||||||||||||||::|.||||||||||||||||||||||||||||||.|. |::|.|    
Zfish    61 KMHNSEISKRLGAEWKLMSEAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKY---- 121

  Fly   336 PYPSVPVEALRAGITPGY-------FAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALER 393
                    :|..|:..|.       ...|.......|.|.:|...:...:.|.::|..:      
Zfish   122 --------SLAGGLLAGSGGGGGVGLGMGAAGVGQRLESPVGHGGSTAASYAHMNGWTN------ 172

  Fly   394 SSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQ 458
            .:|....:.|:|.:|               |.|:  |..|:......||..|...||.....|..
Zfish   173 GAYSGQVAAAAAAAA---------------MMQE--AQLAYGQHPGSGAHHHHGHHHHPHNPQPM 220

  Fly   459 QQQQ---------QQQQLLLSGGGGSGGGGSASSHNNNS--SSGLDDRDATPQL-EAVESKPHLH 511
            .:.:         ...|..:|......||.|.:.|.|:|  |||     |...| ..|:|:|.:.
Zfish   221 HRYEMTALQYSPLSNSQSYMSASPSGYGGISYTQHQNSSVASSG-----AIGALGSLVKSEPSVS 280

  Fly   512 SP 513
            .|
Zfish   281 PP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 62/70 (89%)
sox1bNP_001032751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 9/38 (24%)
SOX-TCF_HMG-box 36..107 CDD:238684 62/70 (89%)
SOXp 106..>198 CDD:289133 27/126 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..219 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.