DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox14

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001032769.1 Gene:sox14 / 557661 ZFINID:ZDB-GENE-051113-268 Length:238 Species:Danio rerio


Alignment Length:220 Identity:102/220 - (46%)
Similarity:125/220 - (56%) Gaps:53/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 EHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMK 310
            :||||||||||||||.||||:||:||||||||||||||||||||:|.||||:|||||||||.|||
Zfish     6 DHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPYIDEAKRLRAQHMK 70

  Fly   311 EHPDYKYRPRRKPK-ALRRDGYPYPMPY-------PSVPVEA----LRAGITPGYFAPGPTAAAY 363
            |||||||||||||| .|::|.|.:|:||       ..:||.|    |.:......|.| ||:|.|
Zfish    71 EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDHLKGLPVSATDSLLGSSEKARAFLP-PTSAPY 134

  Fly   364 HLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDR 428
               |.|..:            |....|:::.:.:.::...|           |..|..|..||:.
Zfish   135 ---SFLDPS------------QFSSSAIQKMTEMPHTLATS-----------TLPYASSLGYQNG 173

  Fly   429 AANYAFDISKIYGA----QQHAAAH 449
            |          :|:    .||...|
Zfish   174 A----------FGSLGCPSQHTHTH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 63/70 (90%)
sox14NP_001032769.1 SOX-TCF_HMG-box 7..78 CDD:238684 63/70 (90%)
SOXp 77..>95 CDD:289133 11/17 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm26545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.