DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox13

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_012818604.1 Gene:sox13 / 549758 XenbaseID:XB-GENE-481889 Length:577 Species:Xenopus tropicalis


Alignment Length:389 Identity:108/389 - (27%)
Similarity:150/389 - (38%) Gaps:78/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQTHLGSGGGTHHLGQLAAAVHQQQQQQ-----QQSDQGLGHSHHLHGQQLSLNHQHHHPHQSPQ 79
            |:..|.|....|.  .:||.:.::||||     ||.:|.:.....|..||          |:...
 Frog   148 LRDQLLSAHSEHR--NMAAMLFEKQQQQMELARQQQEQIVKQQQQLIQQQ----------HKINL 200

  Fly    80 HQQQHQH-------HPCSSNSSNGSPNGSTGLGLHPHSALHLAHHHSQLHQHHPAG----QQQQH 133
            .|||.||       .|....:...:.:....|.:.|.....:.:..|.||.....|    ::|:.
 Frog   201 LQQQIQHVNMPYVMIPAFPPAQTVTADPQMSLPIQPIPCKPVEYPMSLLHNSTTRGSVSAKRQET 265

  Fly   134 SQP------PVSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAPASSSV 192
            |||      |......|..|....:|......|||.....|...|....|      ......:..
 Frog   266 SQPLNLTAKPTDQVPNSRSSPKYRMSPVGSQGGSSMDSASSPQKANLPLG------FLGEGDAIT 324

  Fly   193 MAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEE----------- 246
            .|...|..|.|....||..:..:....|:       |......:|:....|:.|           
 Frog   325 KAIQEACQLLHGQNTSPEHHQQKYRKELL-------DTLPEKEVQDGASLQHTEESVLGCNMDID 382

  Fly   247 -----HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRA 306
                 ||||||||||||::.:||||.|..|.||||.|||.||:.||.::..||:|:.:|..||..
 Frog   383 GSRGSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMSNAEKQPYYEEQARLSR 447

  Fly   307 MHMKEHPDYKYRPRRK------PKALRRDGYPYPMP---------YPSVPVEALRAGITPGYFA 355
            .|::.:|||||:||.|      .|.||...|...|.         |....:.||:...:|..|:
 Frog   448 QHLERYPDYKYKPRPKRTCIVEGKRLRVGEYKALMKNRRQDTRQGYVITSIGALQCPPSPSGFS 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 40/70 (57%)
sox13XP_012818604.1 SOX-TCF_HMG-box 388..459 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.