DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox7

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:300 Identity:79/300 - (26%)
Similarity:118/300 - (39%) Gaps:134/300 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLR 305
            ::.:|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.|:..:|||:::||:|||
 Frog    35 EKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLR 99

  Fly   306 AMHMKEHPDYKYRPRRKPK---------------ALRRD-------------------------- 329
            ..||:::|:||||||||.:               :|.||                          
 Frog   100 VQHMQDYPNYKYRPRRKKQIKRICKRVDTGFLLSSLSRDQNSVPDTRGCRTAVEKEENGGYPGSA 164

  Fly   330 -------------------GYPYPMPYP--SVPVEAL---------------------------- 345
                               .|||.:|.|  ..|:||:                            
 Frog   165 LPDMRHYRETPSNGSKHDQTYPYGLPTPPEMSPLEAIDQDQSFYSTPCSEDCHPHINGAVYEYSS 229

  Fly   346 RAGI------------------------TPGYFAPGPTAAAYHLGSHLGQTSTP----------T 376
            |:.|                        .|.|::....:..::..:||||.|.|          .
 Frog   230 RSPILCSHLSQVPIPQTGSSMIPPVPNCPPAYYSSTYHSIHHNYHAHLGQLSPPPEHPHYDAIDQ 294

  Fly   377 TTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLT 416
            .:||.|.|.||:  .|...||:.|..        |||.:|
 Frog   295 ISQAELLGDMDR--NEFDQYLNTSLH--------DPSEMT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 37/70 (53%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 1/5 (20%)
SOX-TCF_HMG-box 41..112 CDD:238684 37/70 (53%)
Sox17_18_mid 171..218 CDD:371880 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.