Sequence 1: | NP_001261829.1 | Gene: | Sox21b / 39569 | FlyBaseID: | FBgn0042630 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016326.1 | Gene: | sox7 / 549080 | XenbaseID: | XB-GENE-488067 | Length: | 362 | Species: | Xenopus tropicalis |
Alignment Length: | 300 | Identity: | 79/300 - (26%) |
---|---|---|---|
Similarity: | 118/300 - (39%) | Gaps: | 134/300 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 KRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLR 305
Fly 306 AMHMKEHPDYKYRPRRKPK---------------ALRRD-------------------------- 329
Fly 330 -------------------GYPYPMPYP--SVPVEAL---------------------------- 345
Fly 346 RAGI------------------------TPGYFAPGPTAAAYHLGSHLGQTSTP----------T 376
Fly 377 TTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLT 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21b | NP_001261829.1 | SOX-TCF_HMG-box | 247..318 | CDD:238684 | 37/70 (53%) |
sox7 | NP_001016326.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..41 | 1/5 (20%) | |
SOX-TCF_HMG-box | 41..112 | CDD:238684 | 37/70 (53%) | ||
Sox17_18_mid | 171..218 | CDD:371880 | 8/46 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.040 |