DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and SOX18

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:238 Identity:80/238 - (33%)
Similarity:112/238 - (47%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDV 230
            |.:|...|..||.||.:..:||||..            :.|.||..:.......|..:|..    
Human    27 GAAADTRGLAAGPAALAAPAAPASPP------------SPQRSPPRSPEPGRYGLSPAGRG---- 75

  Fly   231 FFSLMIQNTTKRQ--NEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEE 293
                      :||  :|..|:|||||||||::.:|:::||.||.:||:.:||.||..||.|...|
Human    76 ----------ERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAE 130

  Fly   294 KRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKA--LRR-----------DGYPYPMPYPSVPVEAL 345
            ||||::||:|||..|:::||:||||||||.:|  .||           ...|.|.|:|       
Human   131 KRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFP------- 188

  Fly   346 RAGITPGYFAPGPTAAAYH----LGSHLGQTSTPTTTQATLSG 384
                     |...:|.|:.    ||:.......||..::.|.|
Human   189 ---------AASGSARAFRELPPLGAEFDGLGLPTPERSPLDG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 39/70 (56%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 20/86 (23%)
SOX-TCF_HMG-box 84..155 CDD:238684 39/70 (56%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 24/87 (28%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 15/73 (21%)
Sox_C_TAD 193..382 CDD:288887 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.