DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox11

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001008053.1 Gene:sox11 / 493415 XenbaseID:XB-GENE-483418 Length:383 Species:Xenopus tropicalis


Alignment Length:312 Identity:92/312 - (29%)
Similarity:133/312 - (42%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKE 311
            |||||||||||||:::||||.:.:|.|||:|||||||..||:|.:.||.|||.||:|||..||.:
 Frog    47 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMAD 111

  Fly   312 HPDYKYRPRRKPKALRRDGYPYPMPYPSVPVE-ALRAGITPGYFAPGPTAAAYHLGSHLGQTSTP 375
            :||||||||:|||.         .|..|.|.. |.....:|...:.|........|||.|.:|: 
 Frog   112 YPDYKYRPRKKPKV---------DPSASKPASLAQSPEKSPKSRSAGKKCPKLKPGSHSGSSSS- 166

  Fly   376 TTTQATLSGQMDKFALER----SSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDI 436
                   ||......::.    ..|:..|.:|::.:|        |..|   |.:|         
 Frog   167 -------SGSAKSLTIKSEYGGDDYVFGSPKAASKAA--------KCVF---MDED--------- 204

  Fly   437 SKIYGAQQHAAAHHQQQQQQQQQQQQQQQQL-------------LLSGGGGSGGGGSASSHNNNS 488
                 .::......:.:.|.:.:|:::.:.|             |.|....|..|.|......|.
 Frog   205 -----DEEEEEDEEEDELQIRIKQEEEDEPLRQYNVAKVPASPTLSSSSAESAEGASMYEDVRNG 264

  Fly   489 S------SGLDDRDATPQL---------EAVESKPHLHSPS---DVGLDYAQ 522
            :      ..:..:...||.         .|..:.|..|...   |:.|::.|
 Frog   265 TRLYYNFKNITKQSTIPQATITLAPAPRSAGTTSPSSHKDELMFDLSLNFTQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 47/70 (67%)
sox11NP_001008053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SOX-TCF_HMG-box 47..118 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..174 22/75 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..231 6/50 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.