DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox3

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:345 Identity:113/345 - (32%)
Similarity:159/345 - (46%) Gaps:104/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMH 308
            ::|.:||||||||||||.||||:||:|||||||||||||||:||||::.||||||||||||||:|
 Frog    36 DQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSEKRPFIDEAKRLRAVH 100

  Fly   309 MKEHPDYKYRPRRKPKA-LRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAYHLGSHLGQT 372
            |||:||||||||||.|. |::|.|       |:|...|..|::       |.|::..:|..:   
 Frog   101 MKEYPDYKYRPRRKTKTLLKKDKY-------SLPGNLLAPGVS-------PVASSVGVGQRI--- 148

  Fly   373 STPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDIS 437
                .|.|.::|..:                .|||                :.||:         
 Frog   149 ----DTYAHMNGWTN----------------GAYS----------------LMQDQ--------- 168

  Fly   438 KIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGG---SGGGGSASSHNNNSSSGLDDRDATP 499
              .|..||...:..|.||.|.:...          ||   |....||.::.|.::|         
 Frog   169 --LGYSQHPGMNSPQMQQIQHRYDM----------GGLQYSPMMSSAQTYMNAAAS--------- 212

  Fly   500 QLEAVESKPHLHSPSDVGLDYAQYAQQYGGQLAAAAGGAVGGGAAGAAGGSAGGGSGGATAADFR 564
                    .:..||:        |.||....::..:.|:|......:...:....:..|...|.|
 Frog   213 --------TYSMSPA--------YNQQSSTVMSLGSMGSVVKSEPSSPPPAITSHTQRACLGDLR 261

  Fly   565 RPLTVIFXPPSSNGSEELNL 584
            ..:: ::.||..:.|:..:|
 Frog   262 DMIS-MYLPPGGDASDPSSL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 59/70 (84%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/4 (25%)
SOX-TCF_HMG-box 39..110 CDD:238684 59/70 (84%)
SOXp 109..189 CDD:372055 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4121
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.