DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and tHMG1

DIOPT Version :10

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:74 Identity:22/74 - (29%)
Similarity:36/74 - (48%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KRPMNAFMVWSRLQRRK-IAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHM--- 309
            |:||:|||:|.....|| |..::|.....|:|.:.|..|:.:.:|:|..:.:.|....|.:.   
  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73

  Fly   310 ------KEH 312
                  |||
  Fly    74 KQWNFPKEH 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 22/74 (30%)
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 19/66 (29%)

Return to query results.
Submit another query.