DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox17b.1

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_988849.1 Gene:sox17b.1 / 394440 XenbaseID:XB-GENE-484865 Length:376 Species:Xenopus tropicalis


Alignment Length:272 Identity:81/272 - (29%)
Similarity:122/272 - (44%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHM 309
            |..|:|||||||||::.:|:::||.||.:||:|:||.||..||.||...||||::||:|||..|:
 Frog    55 EARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQHI 119

  Fly   310 KEHPDYKYRPRRKP--KALRRD----------------------GYPYPMPYPSVPVEALRAGIT 350
            :::||||||||||.  |.::|:                      |..|.|.|..  ..:.::.||
 Frog   120 QDYPDYKYRPRRKKQVKRMKREEEGFLPSADIPGPQVMGCNAMVGQNYKMQYSG--QNSQQSQIT 182

  Fly   351 P----------GYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALE-RSSYLSNSSQAS 404
            |          ||:..|.....|::..:...|..|..     .|:....:.. .|||:.....||
 Frog   183 PAGYFEDHNPVGYYYRGYNVPEYYMSQNSSVTCGPPA-----QGEYQALSYNFNSSYIPYQQNAS 242

  Fly   405 AYSAYLDPSV-----------------LTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQ 452
            |.:.....:|                 ::...::.:||....|.    ...:...:||::.|..|
 Frog   243 APAMGKQMAVKENIIQESPEHGIMGCQVSPQMYNGQMYVPECAK----THPVAQTEQHSSLHQSQ 303

  Fly   453 QQQQQQQQQQQQ 464
            |...|.....||
 Frog   304 QMVTQNYLPSQQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 40/70 (57%)
sox17b.1NP_988849.1 SOX-TCF_HMG-box 57..128 CDD:238684 40/70 (57%)
PABP-1234 <80..250 CDD:130689 55/176 (31%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:O42601 327..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.