DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox7

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001074219.1 Gene:sox7 / 394203 ZFINID:ZDB-GENE-040109-4 Length:390 Species:Danio rerio


Alignment Length:362 Identity:93/362 - (25%)
Similarity:139/362 - (38%) Gaps:128/362 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNE 245
            :::.|.|.|....|..|.....|.|..:|...:                              :|
Zfish     6 SAYSSWPESFECSAGNADVPDGHTSHRAPADKV------------------------------SE 40

  Fly   246 EHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMK 310
            ..|:|||||||||::.:|:::|..||.:||:|:||.||..||.||..:|||:::||:|||..||:
Zfish    41 PRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTPPQKRPYVEEAERLRVQHMQ 105

  Fly   311 EHPDYKYRPRRKPKALRR------DGY--------PYPMPYPSVPVEAL----RAGITPGYFAPG 357
            ::|:|||||||| |.|:|      .|:        ...:|.|......|    .:|::.|:.:||
Zfish   106 DYPNYKYRPRRK-KQLKRICKRVDPGFLLTTLGPDQNSLPDPRGCCHPLDKDDESGVSGGFGSPG 169

  Fly   358 PTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDS 422
                                  |.|.|    ..:.|....||||                  ||:
Zfish   170 ----------------------AALPG----VRVFRDPASSNSS------------------FDT 190

  Fly   423 KMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNN 487
                     |.:.:..........|..|:.|...                  |.....::|..::
Zfish   191 ---------YPYGLPTPPEMSPLDAVDHEHQSYY------------------SSSSSVSTSSCSS 228

  Fly   488 SSSGLDDRDATPQLEAVESKPHLHSPSDVGLDYAQYA 524
            |:|..:||..||        .|:.||.....||:|.|
Zfish   229 SNSCPEDRRPTP--------AHMSSPPPYHPDYSQQA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 38/70 (54%)
sox7NP_001074219.1 SOX-TCF_HMG-box 42..113 CDD:238684 38/70 (54%)
Sox_C_TAD 174..388 CDD:288887 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.