Sequence 1: | NP_001261829.1 | Gene: | Sox21b / 39569 | FlyBaseID: | FBgn0042630 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011525873.1 | Gene: | MEIOSIN / 388553 | HGNCID: | 44318 | Length: | 644 | Species: | Homo sapiens |
Alignment Length: | 332 | Identity: | 64/332 - (19%) |
---|---|---|---|
Similarity: | 110/332 - (33%) | Gaps: | 120/332 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 NSSNGSPN----------GSTG-----LGLHP-----------------------------HSAL 112
Fly 113 HLAHHHSQLHQHHPAGQQQQHSQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAG 177
Fly 178 GAANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNM--GSLMNSGSSASDVFFSLMIQNTT 240
Fly 241 --------------KRQNEEHI--------------------KRPMNAFMVWSRLQRRKIAQDNP 271
Fly 272 KMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMK---------EHPDYKYRPRRKPKALR 327
Fly 328 RDGYPYP 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21b | NP_001261829.1 | SOX-TCF_HMG-box | 247..318 | CDD:238684 | 18/99 (18%) |
MEIOSIN | XP_011525873.1 | HMG-box | 547..606 | CDD:294061 | 15/58 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |