DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox8b

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001020636.1 Gene:sox8b / 386704 ZFINID:ZDB-GENE-031114-1 Length:358 Species:Danio rerio


Alignment Length:323 Identity:91/323 - (28%)
Similarity:129/323 - (39%) Gaps:122/323 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAM 307
            :::.|:||||||||||::..|||:|...|.:||:|:||.||..|:||||.|||||::||:|||..
Zfish    81 KSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLTESEKRPFVEEAERLRVQ 145

  Fly   308 HMKEHPDYKYRPRRKPKALRRDGYPYPMPYPSVPVEALRAGITPGY---------------FAPG 357
            |.|:||||||:|||                        |..:.||:               ..||
Zfish   146 HKKDHPDYKYQPRR------------------------RKSVKPGHAESEAGSELMQHMYKAEPG 186

  Fly   358 P---TAAAYHLGSHLGQT---STPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLT 416
            .   |.:..|:..|.|.|   .||.||..|...|..|..::.|:              :|.|.|:
Zfish   187 MGRLTGSPDHITDHTGHTHGPPTPPTTPKTEHPQAPKQNIDFSN--------------VDISELS 237

  Fly   417 KAYFDSKMYQDRAANYAFDISKI-------------------YGAQQHAAAHHQQQQQQQQQQQQ 462
                     .|...|..||:.:.                   .||..|....|.:.:|:..|...
Zfish   238 ---------TDVIGNLTFDLQEFDQYLPLTPDQGACSRRAPPAGAHLHPQRVHIKTEQRSPQHYS 293

  Fly   463 QQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDRDATPQLEAVESK------------PHLHSP 513
            :.               |::.::::|||.        |.|..|..            |:||.|
Zfish   294 EH---------------SSTLYSSSSSSA--------QCEYTEHSFYSPYSSYPYPYPYLHRP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 45/70 (64%)
sox8bNP_001020636.1 Sox_N 1..75 CDD:289229
SOX-TCF_HMG-box 85..155 CDD:238684 44/69 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.