DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and HMGB1

DIOPT Version :10

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:80 Identity:23/80 - (28%)
Similarity:45/80 - (56%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHP 313
            |||.:||.::....|.||..::|.:...:::|:||..|.....::|:|:..:|.:|:..:.|:..
Human    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA 160

  Fly   314 DYKYRPRRKPKALRR 328
              .||.:.||.|.::
Human   161 --AYRAKGKPDAAKK 173

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 22/75 (29%)