DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox17

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001101372.1 Gene:Sox17 / 312936 RGDID:1305371 Length:423 Species:Rattus norvegicus


Alignment Length:427 Identity:117/427 - (27%)
Similarity:164/427 - (38%) Gaps:129/427 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GAANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKR 242
            |.|:...|.|.|:.....|...........|.:.::......:.:||:.|.         .:::.
  Rat     7 GYASDDQSQPRSAQPAVMAGLGPCPWAESLSSLGDVKVKGEVVASSGAPAG---------TSSRA 62

  Fly   243 QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAM 307
            :.|..|:|||||||||::.:|:::||.||.:||:|:||.||..||.||..|||||::||:|||..
  Rat    63 KAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQ 127

  Fly   308 HMKEHPDYKYRPRRKP--KALRR--------------------------DGYPYPMPYPSVPVEA 344
            ||::||:|||||||:.  |.::|                          ||...|.|.|..|.  
  Rat   128 HMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALAEPQAGALGPEGGRVAMDGLGLPFPEPGYPA-- 190

  Fly   345 LRAGITPGYFAPGPTAAAYHLGSH------LGQTS-----TPTTTQATLSGQMDKFALERSSYLS 398
                        ||...:.|:|:|      ||..:     .||...:.|.|.....|...:....
  Rat   191 ------------GPPLMSPHMGAHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAAPLPG 243

  Fly   399 NSSQASAY-----SAYL--------------DPSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQ 444
            :...|.||     |.|.              |||       .|.|....|...|..:  .|||..
  Rat   244 DCPAAGAYTYAQVSDYAVPAEPSAGPMRVGPDPS-------GSAMPGILAPPSALHL--YYGAMG 299

  Fly   445 HAAA-----HHQQQQQQQQQQ---------QQQQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDR 495
            ..||     .|.|.||..|.|         ..||..        :.|.|..|.    ....|..|
  Rat   300 SPAASAGRGFHAQPQQPLQPQPPPPPPPPPPPQQHP--------THGPGQPSP----PPEALPCR 352

  Fly   496 DATP---------QLEAVESKPHLH---SPSDVGLDY 520
            |.|.         :::..|.:.:||   .| ::||.|
  Rat   353 DGTEPNQPTELLGEVDRTEFEQYLHFVYKP-EMGLPY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 42/70 (60%)
Sox17NP_001101372.1 SOX-TCF_HMG-box 67..138 CDD:238684 42/70 (60%)
Sox17_18_mid 203..253 CDD:403331 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.