DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox11a

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571411.1 Gene:sox11a / 30602 ZFINID:ZDB-GENE-980526-395 Length:354 Species:Danio rerio


Alignment Length:276 Identity:85/276 - (30%)
Similarity:122/276 - (44%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 SLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLG 283
            |:....:.:.:..|.:.|.....:....|||||||||||||:::||||.:.:|.|||:|||||||
Zfish    12 SMSREATDSDESEFMVSINPDWCKTATGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLG 76

  Fly   284 AEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYP-MPYP--------- 338
            ..||:|.:.||.|||.||:|||..||.::|||||||::|||.   |....| .|.|         
Zfish    77 KRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPKKKPKL---DSSSKPSAPSPEKCSKTSKS 138

  Fly   339 SVPVEALRAGIT------PGY-----FAPGPTAAAYHLGSHLGQ--------------------- 371
            |.....|:|..|      .||     |.....:...|:.|....                     
Zfish   139 SKKCPKLKANKTGSKSSSHGYGDEYAFKSTKVSKTVHIKSEFTDEDDDDDSEEDSRVRVKEEEED 203

  Fly   372 ----------TSTPTTTQATLSGQMDKFALERSSYL-----SNSSQASAYSAYLDPSVLTKAYFD 421
                      .::||.:.:|.|.....:...|::.|     :.:.|::.|.|.:.|:........
Zfish   204 PIRAYNVAKVPASPTLSSSTESEGASMYEEVRNNRLYYNFKNITKQSTMYPASVSPASSRSVSTS 268

  Fly   422 SKMYQDRAANYAFDIS 437
            |...:| |.:..||.|
Zfish   269 SSSSED-ADDLLFDFS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 47/70 (67%)
sox11aNP_571411.1 SOX-TCF_HMG-box 40..107 CDD:238684 43/66 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.