DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and tcf7l1b

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571371.2 Gene:tcf7l1b / 30556 ZFINID:ZDB-GENE-991110-10 Length:550 Species:Danio rerio


Alignment Length:415 Identity:95/415 - (22%)
Similarity:154/415 - (37%) Gaps:114/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HLHGQQLSLNHQHHHPHQSPQHQQQHQHHPCSSNSSNGSP---------NGSTGLGLHPHSALHL 114
            ||..:...:.|.|.|| .:|.....::..|       |:|         :..||:...||.| .|
Zfish   156 HLSNKVPVVQHAHMHP-LTPLITYSNEFPP-------GTPPAHLSPEILDPKTGIPRTPHPA-EL 211

  Fly   115 AHHH-------SQLHQHHPAG----QQQQHSQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGGS 168
            :.::       .|:  .||.|    ||.||.. |:::....|...:.|::....|..||:.    
Zfish   212 SPYYPLSPGAVGQI--PHPLGWLVPQQGQHMY-PITAGGFRHPYPALAMNASMSSLVSSRF---- 269

  Fly   169 ASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLH--------HNSQASPISNLHQNMGSL---MN 222
                         |.|..|           .|.|        |.:..||:.....| |.|   :|
Zfish   270 -------------SPHLVP-----------HHPHGLHQTGIPHPAIVSPVIKQEPN-GELSPPVN 309

  Fly   223 SGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWK 287
            :.|..         .|......:.|||:|:||||::.:..|.|:..:.....::.|::.||..|.
Zfish   310 TKSPG---------PNKKDEDKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWH 365

  Fly   288 LLTEEEKRPFIDEAKRLRAMHMKEHP------DYKYRPRRKPKALRRDGYPYPMPYPS------- 339
            .|:.||:..:.:.|::.|.:|.:.:|      :|..|.:|| :..:.|..|......|       
Zfish   366 SLSREEQAKYYELARKERQLHSQLYPGWSARDNYGKRKKRK-RDNKTDSTPEDFSMRSKKPCVQY 429

  Fly   340 VPVEAL--RAGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFAL----ERSSYL- 397
            :|.|.:  ..|.:.|.....|...:..|.|       |....||.|.|....:|    ||...| 
Zfish   430 LPQEKMIDSPGSSHGSMLDSPATPSAALAS-------PAAPAATHSEQAQPLSLTTKPERFPLLS 487

  Fly   398 -----SNSSQASAYSAYLDPSVLTK 417
                 |:||.:|:.|....|.:|::
Zfish   488 KPPPSSSSSSSSSSSGLPTPPLLSR 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 22/76 (29%)
tcf7l1bNP_571371.2 CTNNB1_binding 1..231 CDD:285538 19/85 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..326 6/37 (16%)
SOX-TCF_HMG-box 325..396 CDD:238684 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.