DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox17

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571362.2 Gene:sox17 / 30544 ZFINID:ZDB-GENE-991213-1 Length:413 Species:Danio rerio


Alignment Length:319 Identity:87/319 - (27%)
Similarity:128/319 - (40%) Gaps:98/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAM 307
            ::|..|:|||||||||::.:|:::||.||.:||:|:||.||..||.|...:||||::||:|||..
Zfish    58 KSEPRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALPMVDKRPFVEEAERLRVK 122

  Fly   308 HMKEHPDYKYRPRRKPKALRR-------------------------------------------D 329
            ||::||:|||||||:.:..|.                                           :
Zfish   123 HMQDHPNYKYRPRRRKQVKRNKRLEPSFPLPGMCDAKMTLCTEGMSAGYSGAGLPQYCENHTLFE 187

  Fly   330 GYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAY---HLGSH--------LGQTSTPTTTQATLS 383
            .|..|.|.|| |::   ||.|. :||.....:|:   |...|        |..|.....||...|
Zfish   188 SYSLPTPDPS-PMD---AGTTE-FFAQLQDQSAFSYHHQQEHHFQEQTNILNDTHCHGNTQTLKS 247

  Fly   384 GQMDKFALERSSYLSNSSQASAYSAYL------------------------------DPS----- 413
            .|....|....:..:||:..:..:|.|                              .||     
Zfish   248 RQSHSIAYSNINTNTNSNLHAPINAQLSSINLQQVFHENANPQISHHPGTHLNIFNRSPSSSSHH 312

  Fly   414 VLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGG 472
            .:|.||.:.....|...|.:..:.::    .|..:.|..:||...:.|.|......|.|
Zfish   313 AMTPAYLNCPSTLDTFYNSSSQMKEL----SHCVSSHTHKQQSIAEAQSQASTATHSSG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 40/70 (57%)
sox17NP_571362.2 SOX-TCF_HMG-box 62..133 CDD:238684 40/70 (57%)
Sox_C_TAD 186..411 CDD:288887 40/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.