DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and tcf7l1a

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571344.1 Gene:tcf7l1a / 30523 ZFINID:ZDB-GENE-980605-30 Length:560 Species:Danio rerio


Alignment Length:496 Identity:106/496 - (21%)
Similarity:161/496 - (32%) Gaps:158/496 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HSHHLH--GQQLSLNHQHHHPHQSPQHQQQHQHHPCSSNSSNGSPNGSTGLGLHPHSALHLAHHH 118
            |.||:|  ...::.:::|..|...|.|.......|            .||:...||.        
Zfish   166 HPHHVHPLTPLITYSNEHFSPGTPPSHLSPEILDP------------KTGIPRTPHP-------- 210

  Fly   119 SQLHQH------------HPAG----QQQQH--SQPPVSSSSTSHHSQSQALSHQTHSNGSSQLG 165
            |:|..:            ||.|    ||.||  |.||   ....|...:.|::....|..||:. 
Zfish   211 SELSPYYPLSPGAVGQIPHPLGWLVPQQGQHMYSIPP---GGFRHPYPALAMNASMSSLVSSRF- 271

  Fly   166 GGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAH----LH-----HNSQASPISNLHQNMGSLM 221
                            |.|..|            |    ||     |.:..||......|..|..
Zfish   272 ----------------SPHMVP------------HPPHGLHQTGIPHPAIVSPAIKQEPNGESPS 308

  Fly   222 NSGSSASDVFFSLMIQNTTKRQNEE--HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGA 284
            ||......|        ..|::.|:  |||:|:||||::.:..|.|:..:.....::.|::.||.
Zfish   309 NSTHGKPSV--------PVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGR 365

  Fly   285 EWKLLTEEEKRPFIDEAKRLRAMHMKEHPDY----KYRPRRKPKALRRDGYPYPMPYPSVPVEAL 345
            .|..|:.||:..:.:.|::.|.:|.:.:|.:    .|..|:|.|...:...|....:...|.:..
Zfish   366 RWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYGKRKKRKRDCKSDSPSESNFSPQPKKQC 430

  Fly   346 RAGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYL 410
            ...::.......||:      ||.....:|.|..|.|:              |.::.|:.:|...
Zfish   431 VPYLSSEKMCDSPTS------SHGSMLDSPATPSAALA--------------SPAAPAATHSEQA 475

  Fly   411 DPSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSG-GGG 474
            .|..||                         .:....|||            ......|.| ..|
Zfish   476 QPLSLT-------------------------TKPEGRAHH------------NHPHFPLPGKSSG 503

  Fly   475 SGGGGSASSHNNNSSSGLDDRDATPQLEAVESKPH---LHS 512
            ||.|.|.:.|  :.|..:......|.|....|..|   |||
Zfish   504 SGSGSSMALH--SLSRPIPFTSLPPSLLGPNSPFHQAALHS 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 21/74 (28%)
tcf7l1aNP_571344.1 CTNNB1_binding 1..233 CDD:285538 17/86 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..328 7/38 (18%)
SOX-TCF_HMG-box 328..399 CDD:238684 21/70 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..513 30/174 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.