DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox19a

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_570983.2 Gene:sox19a / 30038 ZFINID:ZDB-GENE-980526-102 Length:297 Species:Danio rerio


Alignment Length:271 Identity:104/271 - (38%)
Similarity:126/271 - (46%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 STSHHSQSQAL--SHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHN 204
            |...|....|:  :||: :.|.:||.||...|:                                
Zfish     3 SMLEHDMKSAVPPTHQS-AQGMTQLNGGVTHGS-------------------------------- 34

  Fly   205 SQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQD 269
              |.|..|..|...|                       ...:.:||||||||||||.||||:||:
Zfish    35 --AKPAVNSQQQQSS-----------------------DPMDKVKRPMNAFMVWSRGQRRKMAQE 74

  Fly   270 NPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPK-ALRRDGYPY 333
            |||||||||||||||||||||:.||||||||||||||:||||:|||||:||||.| .|::|.   
Zfish    75 NPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTKPVLKKDN--- 136

  Fly   334 PMPYPSVPVEA---LRAGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSS 395
              |....|:.|   |.|....| ....|...:|..| |.|......|.....|.|:.::.|....
Zfish   137 --PAAKYPLSAGNLLAAAAAQG-SGGSPRMDSYGWG-HTGGYPGMQTDALGYSQQLHRYDLSALQ 197

  Fly   396 YLSNSSQASAY 406
            |.|..:.|..|
Zfish   198 YPSAMATAQTY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 61/70 (87%)
sox19aNP_570983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 16/106 (15%)
SOX-TCF_HMG-box 52..123 CDD:238684 61/70 (87%)
SOXp 122..>187 CDD:289133 21/71 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..255
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm26545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.