DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox13

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:403 Identity:109/403 - (27%)
Similarity:162/403 - (40%) Gaps:101/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 THHLGQ--LAAAVHQQQQQQ-----QQSDQGLGHSHHLHGQQLSLN------HQHHHPH-QSPQH 80
            |.|..|  :||.:.::||||     ||.:|.......|..||..:|      .|.:.|: ..|..
  Rat   161 TAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAF 225

  Fly    81 QQQHQHHPCSSNSSNGSPNGSTGLGLHPHSALHLAHHHSQLHQ-------------HHPAGQQQQ 132
            ...||..|.       :|:....|.:.|.....:.:....||.             |||.     
  Rat   226 PSSHQPLPV-------TPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGVATHHPL----- 278

  Fly   133 HSQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAP---------- 187
             .:||...:.|:    ...:|...:::.|..|...|.....|..|.......|:|          
  Rat   279 -QEPPQPLNLTA----KPKVSELPNTSSSPSLKMNSCGPRPSSHGAPTRDLQSSPPNLPLGFLGE 338

  Fly   188 ---ASSSVMAAAAAAHLH----HNSQASPI-------------SNLHQNMGSLMNSGSSASDVFF 232
               .:.::..|....|.|    .||.::|.             ..|.:|....:.......||..
  Rat   339 GDAVTKAIQDARQLLHSHSGALENSPSAPFRKDLISLDSSPAKERLEENCVHPLEEAMLGCDVDG 403

  Fly   233 SLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPF 297
            |   ::.::.:|..||||||||||||::.:||||.|..|.||||.|||.||:.||.:|.:||:|:
  Rat   404 S---RHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPY 465

  Fly   298 IDEAKRLRAMHMKEHPDYKYRPRRKP--------------KAL---RRDG--YPYPMPYPSVPVE 343
            .:|..||...|::::|||||:||.|.              |||   ||.|  ..|     ::|.:
  Rat   466 YEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSY-----AIPPQ 525

  Fly   344 ALRAGITPGYFAP 356
            |.:|.::.....|
  Rat   526 AGQAQVSSDILFP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 41/70 (59%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 31/180 (17%)
SOX-TCF_HMG-box 415..486 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.