DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and ste11

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_596656.1 Gene:ste11 / 2540258 PomBaseID:SPBC32C12.02 Length:468 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:75/354 - (21%)
Similarity:127/354 - (35%) Gaps:88/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 MIQNTTKRQNEE--HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPF 297
            |..:.|..|.::  .:|||:|:||::.|.::.:|    |..::..||:.:|..|:..:.:.|:.:
pombe     1 MSASLTAEQKDQKSSVKRPLNSFMLYRRDRQAEI----PTSNHQSISRIIGQLWRNESAQVKKYY 61

  Fly   298 IDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYP------------------------MPYP 338
            .|.:...|..||.|:|:|||.|:::....||.....|                        ...|
pombe    62 SDLSALERQKHMLENPEYKYTPKKRSTVRRRHKKVSPSSGSFVASDYVVLQQIAQSSKTLKQTEP 126

  Fly   339 SVPV---EALRAGITPGYFAP------------------GPTAAAYHLGSHLGQTSTPTTTQATL 382
            ..||   |.|.|.:.|....|                  .|...::.:.| |..|...:||.:||
pombe   127 EKPVNEEETLAALLAPALSYPKSGKSNLIETSELSCLSSSPMIRSHTIPS-LSFTDQVSTTISTL 190

  Fly   383 SGQMDKFALERSS---YLSNSSQASAYSAYLDPSVLTKAYFDSK--MYQDRAANYAFDISKIYGA 442
                ||.....||   |..:.|..|.........:..||....|  |..|...:.::.:||....
pombe   191 ----DKSEQAPSSLGIYYRSPSSGSPIGRTKSVCLANKARIVPKRSMSSDGCVDKSYQMSKTPSL 251

  Fly   443 QQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNSS------------SGLDDR 495
            :.:...:......::..:...:              |:.|..:|:.|            |.:|.|
pombe   252 EANLPQNSSNCSARRVPKFDSK--------------GTVSEQSNSDSPELSADKVLSHCSPIDAR 302

  Fly   496 DATPQLEAVESKPHLHSPSD-VGLDYAQY 523
            .:||........|...:..| .|.|.|:|
pombe   303 PSTPSCPNASISPKTPNTGDHYGFDGAEY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 22/70 (31%)
ste11NP_596656.1 MATA_HMG-box 16..87 CDD:238685 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.