DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sry

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_036904.1 Gene:Sry / 25221 RGDID:3759 Length:169 Species:Rattus norvegicus


Alignment Length:227 Identity:83/227 - (36%)
Similarity:105/227 - (46%) Gaps:69/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHM 309
            |.|:||||||||||||.:|||:||.||.|.||||||.||.:||.|||.|||||..||:||:.:|.
  Rat     2 EGHVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHR 66

  Fly   310 KEHPDYKYRPRRKPKALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAYHLGSHLGQTST 374
            :::|:|||:|.|:.|..:|                                 :|.|...:..|..
  Rat    67 EKYPNYKYQPHRRVKVPQR---------------------------------SYTLQREVASTKL 98

  Fly   375 PTTTQ------ATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYA 433
            ....|      ..:.||    ...|:::.|:.:|.   |.||.|                     
  Rat    99 YNLLQWDNNLHTIIYGQ----DWARAAHQSSKNQK---SIYLQP--------------------- 135

  Fly   434 FDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQ 465
            .||...|..||  ...|||||....|||||||
  Rat   136 VDIPTGYPLQQ--KQQHQQQQHVHLQQQQQQQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 47/70 (67%)
SryNP_036904.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 50/76 (66%)
SOX-TCF_HMG-box 4..74 CDD:238684 46/69 (67%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 13/15 (87%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 15/31 (48%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 2/5 (40%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000250|UniProtKB:Q05738 92..144 14/79 (18%)
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000250|UniProtKB:Q05738 94..138 11/71 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..169 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.