DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Meiosin

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001357740.1 Gene:Meiosin / 243866 MGIID:3647482 Length:589 Species:Mus musculus


Alignment Length:361 Identity:63/361 - (17%)
Similarity:111/361 - (30%) Gaps:125/361 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SSNGSPNGSTGLGLHPHSALHLAHHHSQLHQHHPAGQQQQHSQPPVSSSSTSHHSQSQALSHQTH 157
            :|..|||||.           ||...||::..|.|    .:....:..||:...|.|:.|.....
Mouse   273 TSEDSPNGSP-----------LALGSSQINTWHVA----DYLNEILGVSSSLFSSPSKILPDHVL 322

  Fly   158 SNGSSQLGGGSASGAGSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQAS---PISNLHQNMGS 219
            .:|:..|      ..|.:....|.....:|....|.:.......:..|..|   ...:|.:|:..
Mouse   323 EDGTYFL------TEGLLESSPATCEVESPQEKEVSSEGPTGPPNFQSSVSLDHCYLSLSENVKV 381

  Fly   220 LMNSGSSASDV----------------------FFSLMIQNTTKRQNEEHI-------------- 248
            |.|.|||:...                      .|||...:..::.|.|.:              
Mouse   382 LSNCGSSSESTDTESLWGQEEVRGVATYPRRTGVFSLAQPSVLQQANPEGLQTSSDEDRDYTWTP 446

  Fly   249 --------------------------------------KRPMNAFMVWSRLQRRKIAQDNPKMHN 275
                                                  |:.:|.|:::.|:.|::..:..|...:
Mouse   447 TGQSSGLPVASKKIKKVQASQGPVKPKDSRKACPGQVKKKCVNGFIMFCRMNRKQYIRACPGTAS 511

  Fly   276 SEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYPMPYPSV 340
            :..:|.|...|:.:|.|||:|:..:|:|....:.:       ..:::..:...|....|.|:..:
Mouse   512 TAATKDLAQLWRGMTLEEKKPYCTKARRFSRQNNR-------IVKQENSSSEDDDGETPKPFYQL 569

  Fly   341 PVEALRAGITPGYFAPGPTAAAYHLGSHLGQTSTPT 376
            ..|..:..                    ||.||.||
Mouse   570 LAEKAQVS--------------------LGLTSLPT 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 16/122 (13%)
MeiosinNP_001357740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 14..27
bHLH_SF 24..73 CDD:412148
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 28..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363 2/20 (10%)
NHP6B 416..>539 CDD:227935 20/122 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..457 2/34 (6%)
HMG-box 484..539 CDD:238037 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..566 2/28 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.