DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox30

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_775560.1 Gene:Sox30 / 214105 MGIID:1341157 Length:782 Species:Mus musculus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:111/284 - (39%) Gaps:85/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAPASSSVMAAAAA 198
            :|||   |:...|.|........|                :|..||.......|.|..:..:.. 
Mouse   274 AQPP---SAFGPHQQDLRFPLTLH----------------TVPPGARIQFQGPPPSELIRLSKV- 318

  Fly   199 AHLHHNSQASPISNLHQNMGSLMN----------------SGSSASDVFFSLMIQNTTKRQNEEH 247
                      |::.:...|.||:.                |.:...|..||        :....|
Mouse   319 ----------PLTPVPIKMQSLLEPSVKIETKDVPLTVLPSDAGIPDTPFS--------KDRNGH 365

  Fly   248 IKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEH 312
            :||||||||||:|:.|..:|:.||..:|:|||.:||.||..|:||:|:|:.|||::::..|.:|.
Mouse   366 VKRPMNAFMVWARIHRPALAKANPAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEF 430

  Fly   313 PDYKYRPR---RK---------------------PKALRRDGYPYPMPYPSVPVEALRAGITPGY 353
            |.:.|:||   ||                     |..:    |||..|..||.:..|:..||   
Mouse   431 PGWVYQPRPGKRKRFPLSVSNVFSGTTQNIISTNPTTI----YPYRSPTYSVVIPGLQNTIT--- 488

  Fly   354 FAPGPTAAAYHLGSHLGQTSTPTT 377
            ...|....|..|.:...|..:|.|
Mouse   489 HPVGEAPPAIQLPTPAVQRPSPIT 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 35/70 (50%)
Sox30NP_775560.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..226
SOX-TCF_HMG-box 365..435 CDD:238684 35/69 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 501..604 3/12 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..724
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 756..782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.