DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox8

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_035577.1 Gene:Sox8 / 20681 MGIID:98370 Length:464 Species:Mus musculus


Alignment Length:455 Identity:129/455 - (28%)
Similarity:182/455 - (40%) Gaps:116/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QQHSQPPVS----SSSTSH--HSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSA--- 186
            :..:|||.|    :||.||  .|.|.|......|.|..:.|||   |.|..| .||:....|   
Mouse     6 EARAQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGGG---GRGDTA-EAADERFPACIR 66

  Fly   187 PASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRP 251
            .|.|.|:..       ::....|:.......|:|                      :.:.|:|||
Mouse    67 DAVSQVLKG-------YDWSLVPMPVRGGGGGTL----------------------KAKPHVKRP 102

  Fly   252 MNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYK 316
            |||||||::..|||:|...|.:||:|:||.||..|:||:|.|||||::||:|||..|.|:|||||
Mouse   103 MNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYK 167

  Fly   317 YRPRRKP--KALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPT--------AAAYHLGSHLGQ 371
            |:|||:.  |..|.|.               .:|...|:...||.        .|.:|...|.||
Mouse   168 YQPRRRKSVKTGRSDS---------------DSGTELGHHPGGPMYKADAVLGEAHHHSDHHTGQ 217

  Fly   372 T---STPTTTQAT-----LSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDR 428
            |   .||.||..|     .:|...:..||....:.:..|...:| .:|.|.|:.....:   .|.
Mouse   218 THGPPTPPTTPKTDLHQASNGSKQELRLEGRRLVDSGRQNIDFS-NVDISELSSEVISN---MDT 278

  Fly   429 AANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSAS----------- 482
            ...:.||  :......|:|...:..|               :...||.||.|.|           
Mouse   279 FDVHEFD--QYLPLNGHSALPTEPSQ---------------ATASGSYGGASYSHSGATGIGASP 326

  Fly   483 --SHNNNSSSGLDDRDA---TPQLEAVESKPHLHSPSDVG----LDYAQYAQQYGGQLAAAAGGA 538
              :|....|:.....:|   .||::..:..|..::....|    .||..|:.|.....||:|..|
Mouse   327 VWAHKGAPSASASPTEAGPLRPQIKTEQLSPSHYNDQSHGSPGRADYGSYSAQASVTTAASATAA 391

  Fly   539  538
            Mouse   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 44/70 (63%)
Sox8NP_035577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 19/52 (37%)
Sox_N 18..86 CDD:315171 22/78 (28%)
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P57073 55..97 9/70 (13%)
SOX-TCF_HMG-box 98..168 CDD:238684 43/69 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..244 33/104 (32%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P57073 221..299 18/83 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..315 8/37 (22%)
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P57073 347..464 12/45 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..374 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4736
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.