DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox7

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_035576.1 Gene:Sox7 / 20680 MGIID:98369 Length:380 Species:Mus musculus


Alignment Length:293 Identity:80/293 - (27%)
Similarity:111/293 - (37%) Gaps:138/293 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRA 306
            :.:|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.||..:|||::|||:|||.
Mouse    39 KSSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRL 103

  Fly   307 MHMKEHPDYKYRPRRKPKALR-------------------------------------------- 327
            .||:::|:||||||||.:..|                                            
Mouse   104 QHMQDYPNYKYRPRRKKQGKRLCKRVDPGFLLSSLSRDQNTLPEKNGIGRGEKEDRGEYSPGATL 168

  Fly   328 -------RDG----------YPYPMPYP------------------------------------- 338
                   |:|          |||.:|.|                                     
Mouse   169 PGLHSCYREGAAAAPGSVDTYPYGLPTPPEMSPLDALEPEQTFFSSSCQEEHGHPHHLPHLPGPP 233

  Fly   339 ------------SVPVEALRAGITPGY--------FAPGP---TAAAYH-----LGSHLGQTSTP 375
                        |.|:.:|..|.:||.        ..|.|   :.|.||     |.:||||.|.|
Mouse   234 YSPEFTPSPLHCSHPLGSLALGQSPGVSMMSSVSGCPPSPAYYSHATYHPLHPNLQAHLGQLSPP 298

  Fly   376 ----------TTTQATLSGQMDKFALERSSYLS 398
                      ..:|..|.|.||:  .|...||:
Mouse   299 PEHPGFDTLDQLSQVELLGDMDR--NEFDQYLN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 39/70 (56%)
Sox7NP_035576.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43 0/3 (0%)
SOX-TCF_HMG-box 44..115 CDD:238684 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 0/27 (0%)
Sox_C_TAD 175..378 CDD:288887 33/157 (21%)
Required for beta-catenin-binding 323..328 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.