Sequence 1: | NP_001261829.1 | Gene: | Sox21b / 39569 | FlyBaseID: | FBgn0042630 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035576.1 | Gene: | Sox7 / 20680 | MGIID: | 98369 | Length: | 380 | Species: | Mus musculus |
Alignment Length: | 293 | Identity: | 80/293 - (27%) |
---|---|---|---|
Similarity: | 111/293 - (37%) | Gaps: | 138/293 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 RQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRA 306
Fly 307 MHMKEHPDYKYRPRRKPKALR-------------------------------------------- 327
Fly 328 -------RDG----------YPYPMPYP------------------------------------- 338
Fly 339 ------------SVPVEALRAGITPGY--------FAPGP---TAAAYH-----LGSHLGQTSTP 375
Fly 376 ----------TTTQATLSGQMDKFALERSSYLS 398 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21b | NP_001261829.1 | SOX-TCF_HMG-box | 247..318 | CDD:238684 | 39/70 (56%) |
Sox7 | NP_035576.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 24..43 | 0/3 (0%) | |
SOX-TCF_HMG-box | 44..115 | CDD:238684 | 39/70 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 139..167 | 0/27 (0%) | |||
Sox_C_TAD | 175..378 | CDD:288887 | 33/157 (21%) | ||
Required for beta-catenin-binding | 323..328 | 1/4 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.940 |