DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox3

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_033263.2 Gene:Sox3 / 20675 MGIID:98365 Length:450 Species:Mus musculus


Alignment Length:484 Identity:147/484 - (30%)
Similarity:189/484 - (39%) Gaps:157/484 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 HPAGQQQQHSQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGGSASGAGSVAGGAANSHHSAPAS 189
            :|.|       ||..::.|...:...|..    .:|::..||.:|...||   |.||        
Mouse    86 NPVG-------PPTPAAGTGVPAAPGAAG----KSGANPAGGANAGNGGS---GGAN-------- 128

  Fly   190 SSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNA 254
                                        |.....|...||               ::.:||||||
Mouse   129 ----------------------------GGGGGGGGGGSD---------------QDRVKRPMNA 150

  Fly   255 FMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRP 319
            ||||||.||||:|.:|||||||||||||||:|||||:.||||||||||||||:||||:|||||||
Mouse   151 FMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRP 215

  Fly   320 RRKPKA-LRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAAAYHLGSHLGQTS---------T 374
            |||.|. |::|.|..|            .|:.|    ||..|||....:....:|         |
Mouse   216 RRKTKTLLKKDKYSLP------------GGLLP----PGAAAAAAAAAAAAAASSPVGVGQRLDT 264

  Fly   375 PTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKI 439
            .|......:|.. ....|:..|    :|..:.|:...|..|      .:|::...|...:.....
Mouse   265 YTHVNGWANGAY-SLVQEQLGY----AQPPSMSSPPPPPAL------PQMHRYDMAGLQYSPMMP 318

  Fly   440 YGAQQH--AAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDRDAT---- 498
            .|||.:  |||                     :....||.||.|.|....:::....:.||    
Mouse   319 PGAQSYMNAAA---------------------AAAAASGYGGMAPSAAAAAAAAYGQQPATAAAA 362

  Fly   499 ----------PQLEAVESKPHLHSPSDVGLDYAQYA---------QQY---GGQLAAAAGGAVGG 541
                      |....|:|:|  .||......::|.|         ..|   ||..|.||....||
Mouse   363 AAAAAAMSLGPMGSVVKSEP--SSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGG 425

  Fly   542 GAAGAAGGSAGGGSGGATAADFRRPLTVI 570
            ...|......|.|    ||.:...|||.|
Mouse   426 RLHGVHQHYQGAG----TAVNGTVPLTHI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 59/70 (84%)
Sox3NP_033263.2 SOX-TCF_HMG-box 143..214 CDD:238684 59/70 (84%)
SOXp 213..306 CDD:289133 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.