DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and Sox13

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_011246247.1 Gene:Sox13 / 20668 MGIID:98361 Length:621 Species:Mus musculus


Alignment Length:408 Identity:119/408 - (29%)
Similarity:170/408 - (41%) Gaps:111/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 THHLGQ--LAAAVHQQQQQQ-----QQSDQGLGHSHHLHGQQLSLN------HQHHHPH-QSPQH 80
            |.|..|  :||.:.::||||     ||.:|.......|..||..:|      .|.:.|: ..|..
Mouse   169 TAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAF 233

  Fly    81 QQQHQHHPCSSNSSNGSPNGSTGLGLHP------HSALHLAH-------HHSQLHQHHPAGQQQQ 132
            ...||..|.       :|:....|.:.|      ...|.|.|       ..|.:..|||.   |:
Mouse   234 PPSHQPLPV-------TPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRSGVAAHHPL---QE 288

  Fly   133 HSQP------------PVSSSS------------TSHHSQSQALSHQTHSNGSSQLGGGSA-SGA 172
            ..||            |.:|||            .||.:.::.|.....|.....||.|.| :.|
Mouse   289 PPQPLNLTAKPKVPELPNTSSSPSLKMNSCGPRPASHGAPTRDLQSSPPSLPLGFLGEGDAVTKA 353

  Fly   173 GSVAGGAANSHHSAPASS----------SVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSGSSA 227
            ...|....:||..|..:|          |:.::.|...|    :.|.:..|.:.|.|....||  
Mouse   354 IQDARQLLHSHSGALENSPNTPFRKDLISLDSSPAKERL----EESCVHPLEEAMLSCDMDGS-- 412

  Fly   228 SDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEE 292
                     ::.::.:|..||||||||||||::.:||||.|..|.||||.|||.||:.||.:|.:
Mouse   413 ---------RHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQ 468

  Fly   293 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKP--------------KAL---RRDG--YPYPMPYP 338
            ||:|:.:|..||...|::::|||||:||.|.              |||   ||.|  ..|     
Mouse   469 EKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSY----- 528

  Fly   339 SVPVEALRAGITPGYFAP 356
            ::|.:|.:|.::.....|
Mouse   529 TIPPQAGQAQVSSDILFP 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 41/70 (59%)
Sox13XP_011246247.1 Atrophin-1 <231..>340 CDD:367360 25/118 (21%)
SOX-TCF_HMG-box 423..494 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.