DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox-3

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_510439.1 Gene:sox-3 / 185534 WormBaseID:WBGene00004950 Length:212 Species:Caenorhabditis elegans


Alignment Length:167 Identity:86/167 - (51%)
Similarity:106/167 - (63%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 QNE-EHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRA 306
            ||. :|:||||||||||||.||||:|||||||||||||||||||||.|:|:||||||||||||||
 Worm    42 QNSLDHVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKQLSEQEKRPFIDEAKRLRA 106

  Fly   307 MHMKEHPDYKYRPRRKPKALRRDGYP-YPMPYPSVP----------VEALRAGITPGYFA----- 355
            :|||||||||||||||||:......| ..:..|::|          .::|:......|::     
 Worm   107 LHMKEHPDYKYRPRRKPKSSNLKQQPRLNIAMPTIPPQSLFNYSTAFDSLKTHDLSQYYSSFFQS 171

  Fly   356 ---PGPTAAAYHL-------------GSHLGQTSTPT 376
               .|.|.|.|::             .|.:..::|||
 Worm   172 PVLSGSTYAPYNMMAAYARQAAAVAAASQVSASTTPT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 63/70 (90%)
sox-3NP_510439.1 SOX-TCF_HMG-box 47..118 CDD:238684 63/70 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.