DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox-2

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:280 Identity:112/280 - (40%)
Similarity:152/280 - (54%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 HNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTK--RQNEEHIKRPMNAFMVWSRLQRRK 265
            |....|..:.|.|:|...:::|..:.|        :|.|  ::|::.:||||||||||||.||:|
 Worm    21 HMPPTSSTNLLPQSMPDDLSNGPDSPD--------STGKDGKKNDDRVKRPMNAFMVWSRGQRKK 77

  Fly   266 IAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKAL-RRD 329
            :|.:||||||||||||||.|||:|:|:||||||||||||||:|||||||||||||||.|:: :::
 Worm    78 MALENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRKTKSINKKN 142

  Fly   330 GYPYPM-----PYPSVPVEALRAGITPGY-----FAPGPT---------AAAYHLGSHLGQTSTP 375
            |.|.|.     ..||.|........|..|     |||.||         :..|.:.|.....|:|
 Worm   143 GAPIPFGNLDTKTPSYPTLTTNWNATNQYIDQFRFAPYPTTTVMDQIPFSLTYPVHSVPTDNSSP 207

  Fly   376 TTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLT------KAYF----DSKMYQDRAA 430
            :..|.  |.....||   .|||:..|::|...:  |.:|.|      :||:    |..||.    
 Worm   208 SQFQP--SPMSTNFA---GSYLTPKSESSPVGS--DSTVGTVDSSQFRAYYDHTKDQMMYP---- 261

  Fly   431 NYAFDISKIYGAQQHAAAHH 450
             |:.:::.....|...:..|
 Worm   262 -YSIELTHAQNIQNALSQSH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 58/70 (83%)
sox-2NP_741836.1 SOX-TCF_HMG-box 59..130 CDD:238684 58/70 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.