DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and egl-13

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:324 Identity:98/324 - (30%)
Similarity:138/324 - (42%) Gaps:75/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LHLAHHHSQ--LHQHHPAGQQQQHSQPPVSSSSTSHHSQSQALSHQTHSNGSSQLGGG--SASGA 172
            ||..:..|:  |.||    :..||.|..:..::....:||..|......|..:.|...  :|:.|
 Worm   159 LHAGNFDSEMLLRQH----ELMQHQQQQMIIANMLKATQSLPLLFNGGLNYEAILNNPVLNATIA 219

  Fly   173 GSVAGGAANSHHSAPASSSVMAAAAAAHLHHNSQA----------------------SPIS---- 211
            |.:....|::......|.|...|||.     |.|.                      ||:|    
 Worm   220 GHLPNPLASNISLLQKSISAKLAAAG-----NMQTVEKVETPLNLSKDTPSPTAIPQSPLSGFRL 279

  Fly   212 --NLHQNMGS--------LMNSGSSASDVFFSLMIQNTTKR---QNEEHIKRPMNAFMVWSRLQR 263
              :|..|.||        ..||...::....|:..:..|.|   ::..||||||||||||:|.:|
 Worm   280 PYSLGTNYGSDGQLFNNCSPNSSGKSTPGNTSVTSEVATPRPQAKSPNHIKRPMNAFMVWARDER 344

  Fly   264 RKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRK------ 322
            |||.:..|.||||.|||.||:.||.::..||:|:.:|..||..:||::||||:||||.|      
 Worm   345 RKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCVID 409

  Fly   323 PKALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGP-------------TAAAYHLGSHLGQTS 373
            .|.:|.:.|...|.    ..:.|..|..||:..|..             ....:|..|||.||:
 Worm   410 GKKVRVNEYKTIMK----TKKDLMWGDEPGFSQPSDLQMDLASHVNLLNDLTQHHHQSHLLQTA 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 41/70 (59%)
egl-13NP_001024918.1 SOX-TCF_HMG-box 328..399 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.