DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox32

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:237 Identity:67/237 - (28%)
Similarity:107/237 - (45%) Gaps:57/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 AHLHHNSQASPISNLHQNMGSLMNSGSSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQR 263
            ||...:...||:|         :.|.||.|        ....|...|..::||:|||::|::.:|
Zfish    38 AHCPASGPLSPVS---------VGSESSCS--------SPEAKAPVETRVRRPLNAFIIWTKEER 85

  Fly   264 RKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRK------ 322
            |::||.||.:.|:::||.||..||.::..:|||::.||:|||..|..::|:|||||||:      
Zfish    86 RRLAQLNPDLENTDLSKILGKTWKAMSLADKRPYMQEAERLRIQHTIDYPNYKYRPRRRKCNKRS 150

  Fly   323 -----------PKALRRDGYPYPMPYPSVPVEALRAGITP-GYFAPGPTAAAYHLGS-------- 367
                       |.|.....|.:....|..|...:.:...| ..|:....:::||..:        
Zfish   151 SKMPSSENVSSPNATFDLSYMFQGQAPQRPYNQINSYRLPHNGFSFENHSSSYHFEATSSSGNVF 215

  Fly   368 HLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAY 409
            |.|.||.          .:....|.||:|    |::..||.:
Zfish   216 HGGATSM----------NLSNVHLPRSAY----SESLLYSQH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 31/70 (44%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.